Example with BLAST
Return to the workshop directory
cd ~/Oct22Workshop
Loading Modules
Many common programs are pre-loaded into the Tufts HPC using a system called "modules".
To see what versions of blast are available as a module, try running this command.
Tip
You can use the first part of the program name to check if there is a module.
module av blast
As of October 2022, these are the modules you might see displayed.
Choose the latest blast-plus version of the module and load it.
module load blast-plus/2.11.0
When there is only one version of a module, the full version does not need to be provided, but it is always best to inclue the version as we are loading and updating versions of programs all of the time.
Confirm that the module is loaded.
module list
tmux and blast should be listed.
If other programs are loaded with the module, they may also show up with this command.
Bringing in Files from the Internet
We need some data! Let's grab the mouse and zebrafish RefSeq protein data sets from NCBI, and put them in our home directory. (this example is adapted from a lesson from Titus Brown's summer institute. These lessons contain a lot of command line examples.
Note
curl
and wget
are the two most common tools used to bring in files that are available from a url. We are going to use curl
because that command works well for files coming from an ftp://
url.
Copying files over from NCBI
For genomics projects, the files are often stored in pubic repositories and we must go and get those files before proceeding. These files originally came from the NCBI FTP site, a copy has been placed in our github directory for future reference.
Now, we'll use curl
to download the files from a Web site onto our computer. You will need to be connected to the internet for these commands to work.
-o
indicates this is the name we are assigning to our files in our own directory-L
provides the full path for the download
It is possible to copy and paste both conmands to your terminal, they will run in sequence if there is not an error.
curl -o mouse.1.protein.faa.gz -L https://tuftsdatalab.github.io/Research_Technology_Bioinformatics/workshops/hpcForLifeSciences_July2022/IntroToLinux/mouse.1.protein.faa.gz
curl -o zebrafish.1.protein.faa.gz -L https://tuftsdatalab.github.io/Research_Technology_Bioinformatics/workshops/hpcForLifeSciences_July2022/IntroToLinux/zebrafish.1.protein.faa.gz
Another method for pulling files from the internet is wget
, which will be demoed tomorrow. curl
can pull more file types than wget
, but in this simple case, either can be used.
If you look at the files in the current directory:
ls -l
You should now see these 3 files with details on who has permissions and when the files were created (notice that the dates are not today).
total 29908
-rw-rw-r-- 1 username01 username01 12553742 Jun 29 08:41 mouse.1.protein.faa.gz
-rw-rw-r-- 1 username01 username01 13963093 Jun 29 08:42 zebrafish.1.protein.faa.gz
The three files you just downloaded are the last three on the list - the
.faa.gz
files.
All three of the files are FASTA protein files (that's what the .faa
suggests) that are compressed with gzip
(that's what the .gz means).
Compressed files may have a different color when you use the ls
command.
Uncompress the files.
gunzip *.faa.gz
Because both files follow a very similar pattern, and we want to decompress all our .gz files, we can use the *
wildcard (filenames that have a pattern that matches and number of missing letters before the part of the file name that is the same
Regular Expressions
*
and other wildcards are useful to save on typing scripts, because many actions can be combined in one request.
Regular Expressions are a set of special characters combined with unix commands.
Here is a link that explains the basic syntax){:target="_blank" rel="noopener"}.
Checking the contents of a File
We've already used cat
and less
to look at the content of our helloworld.txt files. Some files are very large and we may only want to check the first few lines to reassure ourselves that the download worked correctly.
Let's look at the first few sequences in the file:
head mouse.1.protein.faa
!!! note "FASTA format
These are protein sequences in FASTA format. FASTA format is something many of you have probably seen in one form or another -- it's pretty ubiquitous. It's a text file, containing records; each record starts with a line beginning with a '>', and then contains one or more lines of sequence text.
Let's take those first two sequences and save them to a file. We'll do this using output redirection with '>', which says "take all the output and put it into this file here."
head -n 11 mouse.1.protein.faa > mm-first.faa
-n
flag for head
specifies a number of lines to pull.
The first 11 lines contain two protein sequences. Let's extract those for blasting to test that our process is working.
cat mm-first.faa
Should produce:
>YP_220550.1 NADH dehydrogenase subunit 1 (mitochondrion) [Mus musculus domesticus]
MFFINILTLLVPILIAMAFLTLVERKILGYMQLRKGPNIVGPYGILQPFADAMKLFMKEPMRPLTTSMSLFIIAPTLSLT
LALSLWVPLPMPHPLINLNLGILFILATSSLSVYSILWSGWASNSKYSLFGALRAVAQTISYEVTMAIILLSVLLMNGSY
SLQTLITTQEHMWLLLPAWPMAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIILMNALTTI
IFLGPLYYINLPELYSTNFMMEALLLSSTFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHISLPIFTAGVPPYM
>YP_220551.1 NADH dehydrogenase subunit 2 (mitochondrion) [Mus musculus domesticus]
MNPITLAIIYFTIFLGPVITMSSTNLMLMWVGLEFSLLAIIPMLINKKNPRSTEAATKYFVTQATASMIILLAIVLNYKQ
LGTWMFQQQTNGLILNMTLMALSMKLGLAPFHFWLPEVTQGIPLHMGLILLTWQKIAPLSILIQIYPLLNSTIILMLAIT
SIFMGAWGGLNQTQMRKIMAYSSIAHMGWMLAILPYNPSLTLLNLMIYIILTAPMFMALMLNNSMTINSISLLWNKTPAM
LTMISLMLLSLGGLPPLTGFLPKWIIITELMKNNCLIMATLMAMMALLNLFFYTRLIYSTSLTMFPTNNNSKMMTHQTKT
KPNLMFSTLAIMSTMTLPLAPQLIT
Now let's BLAST these two sequences against the entire zebrafish
protein data set. First, we need to tell BLAST that the zebrafish
sequences are (a) a database, and (b) a protein database. That's done
by calling makeblastdb
makeblastdb -in zebrafish.1.protein.faa -dbtype prot
makeblastdb
is a program that was loaded using the module
command. If you unload the module, this command may not work.
Next, we call BLAST to do the search:
blastp -query mm-first.faa -db zebrafish.1.protein.faa
This should run pretty quickly, but you're going to get a lot of output!!
To save it to a file instead of watching it go past on the screen,
ask BLAST to save the output to a file that we'll name mm-first.x.zebrafish.txt
:
blastp -query mm-first.faa -db zebrafish.1.protein.faa -out mm-first.x.zebrafish.txt
and then you can 'page' through this file at your leisure by typing:
less mm-first.x.zebrafish.txt
(Type spacebar to move down, and 'q' to get out of paging mode.)
What are your questions?
Note
This command was an example of interactive
shell scripting because we are typing in the commands manually and waiting for the results. If we walk away from our machine and the session times out, then the program may be interrupted. tmux
allows us to keep running the program even if we take a break.
The next session demonstrates how to combine all of these commands into a script that runs on SLURM.
SLURM differs from interactive
computing because you activate the script instead of manually writing the commands one at a time.